PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G37260.1
Common NameCIR1, MNJ8.4, RVE2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 287aa    MW: 32436.4 Da    PI: 7.5403
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G37260.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-163680147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E+e++v+a k++G   W++I +++g ++t+ q++s+ qk+
      AT5G37260.1 36 REKWTEAEHEKFVEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 80
                     789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.97E-163084IPR009057Homeodomain-like
PROSITE profilePS5129420.7053185IPR017930Myb domain
TIGRFAMsTIGR015571.4E-163483IPR006447Myb domain, plants
SMARTSM007171.6E-123583IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-93676IPR009057Homeodomain-like
PfamPF002491.6E-133679IPR001005SANT/Myb domain
CDDcd001672.30E-93881No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009845Biological Processseed germination
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MAMQERCESL CSDELISSSD AFYLKTRKPY TITKQREKWT EAEHEKFVEA LKLYGRAWRR  60
IEEHVGTKTA VQIRSHAQKF FTKVARDFGV SSESIEIPPP RPKRKPMHPY PRKLVIPDAK  120
EMVYAELTGS KLIQDEDNRS PTSVLSAHGS DGLGSIGSNS PNSSSAELSS HTEESLSLEA  180
ETKQSLKLFG KTFVVGDYNS SMSCDDSEDG KKKLYSETQS LQCSSSTSEN AETEVVVSEF  240
KRSERSAFSQ LKSSVTEMNN MRGFMPYKKR VKVEENIDNV KLSYPLW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.305020.0root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible249606_at0.0
Expression AtlasAT5G37260-
AtGenExpressAT5G37260-
ATTED-IIAT5G37260-
Functional Description ? help Back to Top
Source Description
TAIREncodes a MYB family transcription factor Circadian 1 (CIR1). Involved in circadian regulation in Arabidopsis.
UniProtPositive regulator for cold-responsive gene expression and cold tolerance. Part of a regulatory feedback loop that controls a subset of the circadian outputs and modulates the central oscillator. Negatively self-regulates its own expression. {ECO:0000269|PubMed:17587236, ECO:0000269|PubMed:23371945}.
Function -- GeneRIF ? help Back to Top
  1. CIR1 is possibly part of a regulatory feedback loop that controls a subset of the circadian outputs and modulates the central oscillator.
    [PMID: 17587236]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G37260.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Up-regulated transiently by light. {ECO:0000269|PubMed:17587236, ECO:0000269|PubMed:19805390}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G01060(R), AT1G65480(R), AT2G46830(R), AT5G15840(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G37260, AT5G54230, AT1G10585, AT1G77450
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No effect on the regulation of core clock associated genes or on the hypocotyl length, but hypersensitivity to freezing stress and slightly earlier-flowering phenotype. Rve1 and rve2 double mutant has no alteration in the period or phase of the clock. Rve1, rve2 and rve7 triple mutant has no alteration in the period or phase of the clock. {ECO:0000269|PubMed:17587236, ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23371945}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G37260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195150.0AY519515.1 Arabidopsis thaliana MYB transcription factor (At5g37260) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198542.10.0MYB family transcription factor Circadian 1
SwissprotF4K5X60.0RVE2_ARATH; Protein REVEILLE 2
TrEMBLD7MI690.0D7MI69_ARALL; Putative uncharacterized protein (Fragment)
STRINGAT5G37260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144321922
Representative plantOGRP12551549
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Kasukabe Y, et al.
    Overexpression of spermidine synthase enhances tolerance to multiple environmental stresses and up-regulates the expression of various stress-regulated genes in transgenic Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(6): p. 712-22
    [PMID:15215506]
  3. Mockler TC, et al.
    Regulation of flowering time in Arabidopsis by K homology domain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(34): p. 12759-64
    [PMID:15310842]
  4. Vergnolle C, et al.
    The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions.
    Plant Physiol., 2005. 139(3): p. 1217-33
    [PMID:16258011]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Knight CA, et al.
    Expression profiling and local adaptation of Boechera holboellii populations for water use efficiency across a naturally occurring water stress gradient.
    Mol. Ecol., 2006. 15(5): p. 1229-37
    [PMID:16626450]
  7. Khanna R, et al.
    Functional profiling reveals that only a small number of phytochrome-regulated early-response genes in Arabidopsis are necessary for optimal deetiolation.
    Plant Cell, 2006. 18(9): p. 2157-71
    [PMID:16891401]
  8. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]
  9. Lou Y,Gou JY,Xue HW
    PIP5K9, an Arabidopsis phosphatidylinositol monophosphate kinase, interacts with a cytosolic invertase to negatively regulate sugar-mediated root growth.
    Plant Cell, 2007. 19(1): p. 163-81
    [PMID:17220200]
  10. Tran LS, et al.
    Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis.
    Plant J., 2007. 49(1): p. 46-63
    [PMID:17233795]
  11. Zhang X, et al.
    Constitutive expression of CIR1 (RVE2) affects several circadian-regulated processes and seed germination in Arabidopsis.
    Plant J., 2007. 51(3): p. 512-25
    [PMID:17587236]
  12. Cai X, et al.
    A putative CCAAT-binding transcription factor is a regulator of flowering timing in Arabidopsis.
    Plant Physiol., 2007. 145(1): p. 98-105
    [PMID:17631525]
  13. Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
    Light has a specific role in modulating Arabidopsis gene expression at low temperature.
    BMC Plant Biol., 2008. 8: p. 13
    [PMID:18230142]
  14. Usadel B, et al.
    Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes.
    Plant Physiol., 2008. 146(4): p. 1834-61
    [PMID:18305208]
  15. L
    Knocking out cytosolic cysteine synthesis compromises the antioxidant capacity of the cytosol to maintain discrete concentrations of hydrogen peroxide in Arabidopsis.
    Plant Physiol., 2008. 147(2): p. 562-72
    [PMID:18441224]
  16. Rawat R, et al.
    REVEILLE1, a Myb-like transcription factor, integrates the circadian clock and auxin pathways.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(39): p. 16883-8
    [PMID:19805390]
  17. Filichkin SA,Mockler TC
    Unproductive alternative splicing and nonsense mRNAs: a widespread phenomenon among plant circadian clock genes.
    Biol. Direct, 2012. 7: p. 20
    [PMID:22747664]
  18. Guan Q, et al.
    A DEAD box RNA helicase is critical for pre-mRNA splicing, cold-responsive gene regulation, and cold tolerance in Arabidopsis.
    Plant Cell, 2013. 25(1): p. 342-56
    [PMID:23371945]
  19. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  20. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]